PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_4AL_792F1D482.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family bZIP
Protein Properties Length: 83aa    MW: 9800.33 Da    PI: 10.7994
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_4AL_792F1D482.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_129.12.2e-09668163
                           XXXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                 bZIP_1  1 ekelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63
                           eke kr rr   NRe+Ar   +R++a  +eL++kv+ L ++N+ +kke ++  +++ +lk  +
  Traes_4AL_792F1D482.1  6 EKEAKRLRRVLANRESARQTILRRQAIRDELARKVADLASQNENMKKEKDKVLEQYLTLKETN 68
                           89*************************************************999999999876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.5E-9670IPR004827Basic-leucine zipper domain
PfamPF001707.9E-9669IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.749871IPR004827Basic-leucine zipper domain
SuperFamilySSF579594.58E-71066No hitNo description
Gene3DG3DSA:1.20.5.1703.7E-51066No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 83 aa     Download sequence    Send to blast
MLTEAEKEAK RLRRVLANRE SARQTILRRQ AIRDELARKV ADLASQNENM KKEKDKVLEQ  60
YLTLKETNKQ LKQQAHHLSL SFL
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3596221e-112AK359622.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1100C17.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010237936.12e-46PREDICTED: G-box-binding factor 1
TrEMBLR7W9R63e-51R7W9R6_AEGTA; DNA-binding protein EMBP-1
TrEMBLW5DQJ21e-51W5DQJ2_WHEAT; Uncharacterized protein
STRINGMLOC_15316.13e-43(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP31653475
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G19490.15e-18bZIP family protein
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]